1. Packages
  2. Packages
  3. Fortimanager Provider
  4. API Docs
  5. WantempSystemSdwanHealthcheckSla
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev

    Service level agreement (SLA).

    This resource is a sub resource for variable sla of resource fortimanager.WantempSystemSdwanHealthcheck. Conflict and overwrite may occur if use both of them.

    Create WantempSystemSdwanHealthcheckSla Resource

    Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.

    Constructor syntax

    new WantempSystemSdwanHealthcheckSla(name: string, args: WantempSystemSdwanHealthcheckSlaArgs, opts?: CustomResourceOptions);
    @overload
    def WantempSystemSdwanHealthcheckSla(resource_name: str,
                                         args: WantempSystemSdwanHealthcheckSlaInitArgs,
                                         opts: Optional[ResourceOptions] = None)
    
    @overload
    def WantempSystemSdwanHealthcheckSla(resource_name: str,
                                         opts: Optional[ResourceOptions] = None,
                                         health_check: Optional[str] = None,
                                         wanprof: Optional[str] = None,
                                         link_cost_factors: Optional[Sequence[str]] = None,
                                         fosid: Optional[float] = None,
                                         jitter_threshold: Optional[float] = None,
                                         latency_threshold: Optional[float] = None,
                                         adom: Optional[str] = None,
                                         mos_threshold: Optional[str] = None,
                                         packetloss_threshold: Optional[float] = None,
                                         priority_in_sla: Optional[float] = None,
                                         priority_out_sla: Optional[float] = None,
                                         scopetype: Optional[str] = None,
                                         update_if_exist: Optional[bool] = None,
                                         custom_profile_threshold: Optional[float] = None,
                                         wantemp_system_sdwan_healthcheck_sla_id: Optional[str] = None)
    func NewWantempSystemSdwanHealthcheckSla(ctx *Context, name string, args WantempSystemSdwanHealthcheckSlaArgs, opts ...ResourceOption) (*WantempSystemSdwanHealthcheckSla, error)
    public WantempSystemSdwanHealthcheckSla(string name, WantempSystemSdwanHealthcheckSlaArgs args, CustomResourceOptions? opts = null)
    public WantempSystemSdwanHealthcheckSla(String name, WantempSystemSdwanHealthcheckSlaArgs args)
    public WantempSystemSdwanHealthcheckSla(String name, WantempSystemSdwanHealthcheckSlaArgs args, CustomResourceOptions options)
    
    type: fortimanager:WantempSystemSdwanHealthcheckSla
    properties: # The arguments to resource properties.
    options: # Bag of options to control resource's behavior.
    
    
    resource "fortimanager_wantempsystemsdwanhealthchecksla" "name" {
        # resource properties
    }

    Parameters

    name string
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckSlaArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    resource_name str
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckSlaInitArgs
    The arguments to resource properties.
    opts ResourceOptions
    Bag of options to control resource's behavior.
    ctx Context
    Context object for the current deployment.
    name string
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckSlaArgs
    The arguments to resource properties.
    opts ResourceOption
    Bag of options to control resource's behavior.
    name string
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckSlaArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    name String
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckSlaArgs
    The arguments to resource properties.
    options CustomResourceOptions
    Bag of options to control resource's behavior.

    Constructor example

    The following reference example uses placeholder values for all input properties.

    var wantempSystemSdwanHealthcheckSlaResource = new Fortimanager.WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource", new()
    {
        HealthCheck = "string",
        Wanprof = "string",
        LinkCostFactors = new[]
        {
            "string",
        },
        Fosid = 0,
        JitterThreshold = 0,
        LatencyThreshold = 0,
        Adom = "string",
        MosThreshold = "string",
        PacketlossThreshold = 0,
        PriorityInSla = 0,
        PriorityOutSla = 0,
        Scopetype = "string",
        UpdateIfExist = false,
        CustomProfileThreshold = 0,
        WantempSystemSdwanHealthcheckSlaId = "string",
    });
    
    example, err := fortimanager.NewWantempSystemSdwanHealthcheckSla(ctx, "wantempSystemSdwanHealthcheckSlaResource", &fortimanager.WantempSystemSdwanHealthcheckSlaArgs{
    	HealthCheck: pulumi.String("string"),
    	Wanprof:     pulumi.String("string"),
    	LinkCostFactors: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	Fosid:                              pulumi.Float64(0),
    	JitterThreshold:                    pulumi.Float64(0),
    	LatencyThreshold:                   pulumi.Float64(0),
    	Adom:                               pulumi.String("string"),
    	MosThreshold:                       pulumi.String("string"),
    	PacketlossThreshold:                pulumi.Float64(0),
    	PriorityInSla:                      pulumi.Float64(0),
    	PriorityOutSla:                     pulumi.Float64(0),
    	Scopetype:                          pulumi.String("string"),
    	UpdateIfExist:                      pulumi.Bool(false),
    	CustomProfileThreshold:             pulumi.Float64(0),
    	WantempSystemSdwanHealthcheckSlaId: pulumi.String("string"),
    })
    
    resource "fortimanager_wantempsystemsdwanhealthchecksla" "wantempSystemSdwanHealthcheckSlaResource" {
      health_check                            = "string"
      wanprof                                 = "string"
      link_cost_factors                       = ["string"]
      fosid                                   = 0
      jitter_threshold                        = 0
      latency_threshold                       = 0
      adom                                    = "string"
      mos_threshold                           = "string"
      packetloss_threshold                    = 0
      priority_in_sla                         = 0
      priority_out_sla                        = 0
      scopetype                               = "string"
      update_if_exist                         = false
      custom_profile_threshold                = 0
      wantemp_system_sdwan_healthcheck_sla_id = "string"
    }
    
    var wantempSystemSdwanHealthcheckSlaResource = new WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource", WantempSystemSdwanHealthcheckSlaArgs.builder()
        .healthCheck("string")
        .wanprof("string")
        .linkCostFactors("string")
        .fosid(0.0)
        .jitterThreshold(0.0)
        .latencyThreshold(0.0)
        .adom("string")
        .mosThreshold("string")
        .packetlossThreshold(0.0)
        .priorityInSla(0.0)
        .priorityOutSla(0.0)
        .scopetype("string")
        .updateIfExist(false)
        .customProfileThreshold(0.0)
        .wantempSystemSdwanHealthcheckSlaId("string")
        .build());
    
    wantemp_system_sdwan_healthcheck_sla_resource = fortimanager.WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource",
        health_check="string",
        wanprof="string",
        link_cost_factors=["string"],
        fosid=float(0),
        jitter_threshold=float(0),
        latency_threshold=float(0),
        adom="string",
        mos_threshold="string",
        packetloss_threshold=float(0),
        priority_in_sla=float(0),
        priority_out_sla=float(0),
        scopetype="string",
        update_if_exist=False,
        custom_profile_threshold=float(0),
        wantemp_system_sdwan_healthcheck_sla_id="string")
    
    const wantempSystemSdwanHealthcheckSlaResource = new fortimanager.WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource", {
        healthCheck: "string",
        wanprof: "string",
        linkCostFactors: ["string"],
        fosid: 0,
        jitterThreshold: 0,
        latencyThreshold: 0,
        adom: "string",
        mosThreshold: "string",
        packetlossThreshold: 0,
        priorityInSla: 0,
        priorityOutSla: 0,
        scopetype: "string",
        updateIfExist: false,
        customProfileThreshold: 0,
        wantempSystemSdwanHealthcheckSlaId: "string",
    });
    
    type: fortimanager:WantempSystemSdwanHealthcheckSla
    properties:
        adom: string
        customProfileThreshold: 0
        fosid: 0
        healthCheck: string
        jitterThreshold: 0
        latencyThreshold: 0
        linkCostFactors:
            - string
        mosThreshold: string
        packetlossThreshold: 0
        priorityInSla: 0
        priorityOutSla: 0
        scopetype: string
        updateIfExist: false
        wanprof: string
        wantempSystemSdwanHealthcheckSlaId: string
    

    WantempSystemSdwanHealthcheckSla Resource Properties

    To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.

    Inputs

    In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.

    The WantempSystemSdwanHealthcheckSla resource accepts the following input properties:

    HealthCheck string
    Health Check.
    Wanprof string
    Wanprof.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    CustomProfileThreshold double
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    Fosid double
    SLA ID.
    JitterThreshold double
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LatencyThreshold double
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LinkCostFactors List<string>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    MosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    PacketlossThreshold double
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    PriorityInSla double
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    PriorityOutSla double
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    WantempSystemSdwanHealthcheckSlaId string
    an identifier for the resource with format {{fosid}}.
    HealthCheck string
    Health Check.
    Wanprof string
    Wanprof.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    CustomProfileThreshold float64
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    Fosid float64
    SLA ID.
    JitterThreshold float64
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LatencyThreshold float64
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LinkCostFactors []string
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    MosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    PacketlossThreshold float64
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    PriorityInSla float64
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    PriorityOutSla float64
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    WantempSystemSdwanHealthcheckSlaId string
    an identifier for the resource with format {{fosid}}.
    health_check string
    Health Check.
    wanprof string
    Wanprof.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    custom_profile_threshold number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid number
    SLA ID.
    jitter_threshold number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latency_threshold number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    link_cost_factors list(string)
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mos_threshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetloss_threshold number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priority_in_sla number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priority_out_sla number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    wantemp_system_sdwan_healthcheck_sla_id string
    an identifier for the resource with format {{fosid}}.
    healthCheck String
    Health Check.
    wanprof String
    Wanprof.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    customProfileThreshold Double
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid Double
    SLA ID.
    jitterThreshold Double
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold Double
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors List<String>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold String
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold Double
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla Double
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla Double
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    wantempSystemSdwanHealthcheckSlaId String
    an identifier for the resource with format {{fosid}}.
    healthCheck string
    Health Check.
    wanprof string
    Wanprof.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    customProfileThreshold number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid number
    SLA ID.
    jitterThreshold number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors string[]
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist boolean
    wantempSystemSdwanHealthcheckSlaId string
    an identifier for the resource with format {{fosid}}.
    health_check str
    Health Check.
    wanprof str
    Wanprof.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    custom_profile_threshold float
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid float
    SLA ID.
    jitter_threshold float
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latency_threshold float
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    link_cost_factors Sequence[str]
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mos_threshold str
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetloss_threshold float
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priority_in_sla float
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priority_out_sla float
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    wantemp_system_sdwan_healthcheck_sla_id str
    an identifier for the resource with format {{fosid}}.
    healthCheck String
    Health Check.
    wanprof String
    Wanprof.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    customProfileThreshold Number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid Number
    SLA ID.
    jitterThreshold Number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold Number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors List<String>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold String
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold Number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla Number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla Number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    wantempSystemSdwanHealthcheckSlaId String
    an identifier for the resource with format {{fosid}}.

    Outputs

    All input properties are implicitly available as output properties. Additionally, the WantempSystemSdwanHealthcheckSla resource produces the following output properties:

    Id string
    The provider-assigned unique ID for this managed resource.
    Id string
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id str
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.

    Look up Existing WantempSystemSdwanHealthcheckSla Resource

    Get an existing WantempSystemSdwanHealthcheckSla resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.

    public static get(name: string, id: Input<ID>, state?: WantempSystemSdwanHealthcheckSlaState, opts?: CustomResourceOptions): WantempSystemSdwanHealthcheckSla
    @staticmethod
    def get(resource_name: str,
            id: str,
            opts: Optional[ResourceOptions] = None,
            adom: Optional[str] = None,
            custom_profile_threshold: Optional[float] = None,
            fosid: Optional[float] = None,
            health_check: Optional[str] = None,
            jitter_threshold: Optional[float] = None,
            latency_threshold: Optional[float] = None,
            link_cost_factors: Optional[Sequence[str]] = None,
            mos_threshold: Optional[str] = None,
            packetloss_threshold: Optional[float] = None,
            priority_in_sla: Optional[float] = None,
            priority_out_sla: Optional[float] = None,
            scopetype: Optional[str] = None,
            update_if_exist: Optional[bool] = None,
            wanprof: Optional[str] = None,
            wantemp_system_sdwan_healthcheck_sla_id: Optional[str] = None) -> WantempSystemSdwanHealthcheckSla
    func GetWantempSystemSdwanHealthcheckSla(ctx *Context, name string, id IDInput, state *WantempSystemSdwanHealthcheckSlaState, opts ...ResourceOption) (*WantempSystemSdwanHealthcheckSla, error)
    public static WantempSystemSdwanHealthcheckSla Get(string name, Input<string> id, WantempSystemSdwanHealthcheckSlaState? state, CustomResourceOptions? opts = null)
    public static WantempSystemSdwanHealthcheckSla get(String name, Output<String> id, WantempSystemSdwanHealthcheckSlaState state, CustomResourceOptions options)
    resources:  _:    type: fortimanager:WantempSystemSdwanHealthcheckSla    get:      id: ${id}
    import {
      to = fortimanager_wantempsystemsdwanhealthchecksla.example
      id = "${id}"
    }
    
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    resource_name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    The following state arguments are supported:
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    CustomProfileThreshold double
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    Fosid double
    SLA ID.
    HealthCheck string
    Health Check.
    JitterThreshold double
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LatencyThreshold double
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LinkCostFactors List<string>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    MosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    PacketlossThreshold double
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    PriorityInSla double
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    PriorityOutSla double
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    Wanprof string
    Wanprof.
    WantempSystemSdwanHealthcheckSlaId string
    an identifier for the resource with format {{fosid}}.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    CustomProfileThreshold float64
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    Fosid float64
    SLA ID.
    HealthCheck string
    Health Check.
    JitterThreshold float64
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LatencyThreshold float64
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LinkCostFactors []string
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    MosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    PacketlossThreshold float64
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    PriorityInSla float64
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    PriorityOutSla float64
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    Wanprof string
    Wanprof.
    WantempSystemSdwanHealthcheckSlaId string
    an identifier for the resource with format {{fosid}}.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    custom_profile_threshold number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid number
    SLA ID.
    health_check string
    Health Check.
    jitter_threshold number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latency_threshold number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    link_cost_factors list(string)
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mos_threshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetloss_threshold number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priority_in_sla number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priority_out_sla number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    wanprof string
    Wanprof.
    wantemp_system_sdwan_healthcheck_sla_id string
    an identifier for the resource with format {{fosid}}.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    customProfileThreshold Double
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid Double
    SLA ID.
    healthCheck String
    Health Check.
    jitterThreshold Double
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold Double
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors List<String>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold String
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold Double
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla Double
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla Double
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    wanprof String
    Wanprof.
    wantempSystemSdwanHealthcheckSlaId String
    an identifier for the resource with format {{fosid}}.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    customProfileThreshold number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid number
    SLA ID.
    healthCheck string
    Health Check.
    jitterThreshold number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors string[]
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist boolean
    wanprof string
    Wanprof.
    wantempSystemSdwanHealthcheckSlaId string
    an identifier for the resource with format {{fosid}}.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    custom_profile_threshold float
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid float
    SLA ID.
    health_check str
    Health Check.
    jitter_threshold float
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latency_threshold float
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    link_cost_factors Sequence[str]
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mos_threshold str
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetloss_threshold float
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priority_in_sla float
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priority_out_sla float
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    wanprof str
    Wanprof.
    wantemp_system_sdwan_healthcheck_sla_id str
    an identifier for the resource with format {{fosid}}.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    customProfileThreshold Number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    fosid Number
    SLA ID.
    healthCheck String
    Health Check.
    jitterThreshold Number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold Number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors List<String>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold String
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold Number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla Number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla Number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    wanprof String
    Wanprof.
    wantempSystemSdwanHealthcheckSlaId String
    an identifier for the resource with format {{fosid}}.

    Import

    Wantemp SystemSdwanHealthCheckSla can be imported using any of these accepted formats:

    Set import_options = [“wanprof=YOUR_VALUE”, “health_check=YOUR_VALUE”] in the provider section.

    $ export “FORTIMANAGER_IMPORT_TABLE”=“true”

    $ pulumi import fortimanager:index/wantempSystemSdwanHealthcheckSla:WantempSystemSdwanHealthcheckSla labelname {{fosid}}
    

    $ unset “FORTIMANAGER_IMPORT_TABLE”

    -> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.

    To learn more about importing existing cloud resources, see Importing resources.

    Package Details

    Repository
    fortimanager fortinetdev/terraform-provider-fortimanager
    License
    Notes
    This Pulumi package is based on the fortimanager Terraform Provider.
    Viewing docs for fortimanager 1.17.0
    published on Monday, May 4, 2026 by fortinetdev
      Try Pulumi Cloud free. Your team will thank you.